The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Escherichia Coli.
Sterile Filtered White lyophilized (freeze-dried) powder.
Lyophilized white powder containing no additives.
Reconstitution with deionized water or PBS.
Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.
Please prevent freeze-thaw cycles.
>96% as determined by SDS-PAGE and RP-HPLC.
LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
1. IgG Binding activity Under optimal conditions: 1 mg protein G will bind ~5 mg. human IgG at pH 5-6.
2. IgG s: 3 sites.
3. Isoelectric Point: 4.55.
4. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a.
5. Does not bind to human IgM, IgD and IgA.
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
