Catalogue number
CYT-085
Synonyms
Prostatropin, HBGH-2, HBGF-2, FGF-2, FGF-b.
Introduction
Basic fibroblast growth factor is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described. The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.
Description
FGF-2 Human Recombinant Thermostable produced in HEK cells is a non-glycosylated monomer, containing 154 amino acids and having a total molecular weight of 17kDa.
FGF-2 Thermostable is a protein engineered FGF2 in order to enhance its thermostability without modifying its biological function.
The FGF-b is purified by proprietary chromatographic techniques.
Source
HEK.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The FGF2 was filtered (0.2μm) and lyophilized from 0.68mg/ml in 1xPBS.
Solubility
It is recommended to reconstitute the lyophilized FGF-b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Stability
Lyophilized FGF-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-b should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Purity
Greater than 95% as obsereved by SDS-PAGE.
Amino acid sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGV
VSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYK.
Safety Data Sheet
Biological Activity
The specific activity was determined by the dose dependent stimulation of proliferation of the Balb/c 3T3 cell line, the ED50 is 0.007ng/ml.
Usage
ProSpecs products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.